PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P07760_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 23952.5 Da    PI: 9.695
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P07760_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.31.1e-291059251
                            ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            rien   rqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gkly +ss
  GSMUA_Achr11P07760_001 10 RIENAASRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYQFSS 59
                            8***********************************************96 PP

2K-box77.53.5e-26801737100
                   K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                             +sl ++k+++l  e++++ k+ie ++ ++R+llGe+Les+s +eL++L +qLe+sl++iR++K+ +l+eqi el++ke++l +enk 
  GSMUA_Achr11P07760_001  80 QSLVDQKMQNLVSEAKNMAKQIELIEAQKRKLLGESLESCSAEELHELGNQLEESLRQIRNRKHSILTEQIAELKEKERSLMQENKL 166
                             457899********************************************************************************* PP

                   K-box  94 Lrkklee 100
                             Lr+k++e
  GSMUA_Achr11P07760_001 167 LREKFKE 173
                             ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.917161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-31373IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002654.92E-41375No hitNo description
PfamPF003196.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.6E-2585171IPR002487Transcription factor, K-box
PROSITE profilePS5129714.37487177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MVRGKTEMRR IENAASRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYQFSSS  60
SVEKTIHRYM IHTKDVNCKQ SLVDQKMQNL VSEAKNMAKQ IELIEAQKRK LLGESLESCS  120
AEELHELGNQ LEESLRQIRN RKHSILTEQI AELKEKERSL MQENKLLREK FKEGNMPQLH  180
AAEFAASDRN AQSMEVETEL MIGRPGTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-20369268Myocyte-specific enhancer factor 2A
3kov_B2e-20369268Myocyte-specific enhancer factor 2A
3kov_I2e-20369268Myocyte-specific enhancer factor 2A
3kov_J2e-20369268Myocyte-specific enhancer factor 2A
3mu6_A1e-20372271Myocyte-specific enhancer factor 2A
3mu6_B1e-20372271Myocyte-specific enhancer factor 2A
3mu6_C1e-20372271Myocyte-specific enhancer factor 2A
3mu6_D1e-20372271Myocyte-specific enhancer factor 2A
3p57_A2e-20369268Myocyte-specific enhancer factor 2A
3p57_B2e-20369268Myocyte-specific enhancer factor 2A
3p57_C2e-20369268Myocyte-specific enhancer factor 2A
3p57_D2e-20369268Myocyte-specific enhancer factor 2A
3p57_I2e-20369268Myocyte-specific enhancer factor 2A
3p57_J2e-20369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0999375e-53AF099937.2 Hyacinthus orientalis AGAMOUS homolog transcription factor (HAG1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382800.11e-150PREDICTED: MADS-box transcription factor 50-like
SwissprotQ9XJ604e-74MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RQA61e-150M0RQA6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P07760_0011e-150(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-69AGAMOUS-like 20